PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G64000.1
Common NameATWRKY56, F22C12.23, WRKY56
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 195aa    MW: 21774.4 Da    PI: 8.2183
Description WRKY DNA-binding protein 56
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G64000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.98.9e-33113171159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+
  AT1G64000.1 113 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGVHNHP 171
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-32100171IPR003657WRKY domain
SuperFamilySSF1182901.31E-28105172IPR003657WRKY domain
PROSITE profilePS5081129.241108173IPR003657WRKY domain
SMARTSM007742.0E-38113172IPR003657WRKY domain
PfamPF031062.8E-26114171IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MEGVDNTNPM LTLEEGENNN PFSSLDDKTL MMMAPSLIFS GDVGPSSSSC TPAGYHLSAQ  60
LENFRGGGGE MGGLVSNNSN NSDHNKNCNK GKGKRTLAMQ RIAFHTRSDD DVLDDGYRWR  120
KYGQKSVKNN AHPRSYYRCT YHTCNVKKQV QRLAKDPNVV VTTYEGVHNH PCEKLMETLS  180
PLLRQLQFLS RVSDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26103170774Probable WRKY transcription factor 4
2lex_A2e-26103170774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306969450.0
Genevisible262339_at0.0
Expression AtlasAT1G64000-
AtGenExpressAT1G64000-
ATTED-IIAT1G64000-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G64000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G64000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0718480.0AY071848.1 Arabidopsis thaliana WRKY transcription factor 56 (WRKY56) mRNA, complete cds.
GenBankBT0248350.0BT024835.1 Arabidopsis thaliana At1g64000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176583.11e-147putative WRKY transcription factor 56
SwissprotQ8VWQ41e-148WRK56_ARATH; Probable WRKY transcription factor 56
TrEMBLQ29PS11e-146Q29PS1_ARATH; At1g64000
STRINGAT1G64000.11e-146(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Giancola S, et al.
    Characterization of a radish introgression carrying the Ogura fertility restorer gene Rfo in rapeseed, using the Arabidopsis genome sequence and radish genetic mapping.
    Theor. Appl. Genet., 2003. 107(8): p. 1442-51
    [PMID:12942173]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Zhao J, et al.
    Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus.
    Planta, 2007. 227(1): p. 13-24
    [PMID:17665211]